From patchwork Fri Aug 4 21:00:22 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710544 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 14BA0C04FE2 for ; Fri, 4 Aug 2023 21:26:20 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230208AbjHDV0S (ORCPT ); Fri, 4 Aug 2023 17:26:18 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44150 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231186AbjHDV0Q (ORCPT ); Fri, 4 Aug 2023 17:26:16 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 1D2514C3B; Fri, 4 Aug 2023 14:26:12 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id a6286e61ff4363f4; Fri, 4 Aug 2023 23:26:11 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id BAA3D6624B9; Fri, 4 Aug 2023 23:26:10 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 01/10] thermal: core: Do not handle trip points with invalid temperature Date: Fri, 04 Aug 2023 23:00:22 +0200 Message-ID: <4850902.GXAFRqVoOG@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Trip points with temperature set to THERMAL_TEMP_INVALID are as good as disabled, so make handle_thermal_trip() ignore them. Signed-off-by: Rafael J. Wysocki Acked-by: Daniel Lezcano --- v3 -> v4: No changes. v2 -> v3: No changes. v1 -> v2: No changes. --- drivers/thermal/thermal_core.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -348,7 +348,8 @@ static void handle_thermal_trip(struct t struct thermal_trip trip; /* Ignore disabled trip points */ - if (test_bit(trip_id, &tz->trips_disabled)) + if (test_bit(trip_id, &tz->trips_disabled) || + trip.temperature == THERMAL_TEMP_INVALID) return; __thermal_zone_get_trip(tz, trip_id, &trip); From patchwork Fri Aug 4 21:03:23 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710776 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id DDD06C04A6A for ; Fri, 4 Aug 2023 21:26:20 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231229AbjHDV0T (ORCPT ); Fri, 4 Aug 2023 17:26:19 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44152 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231183AbjHDV0Q (ORCPT ); Fri, 4 Aug 2023 17:26:16 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 46987E43; Fri, 4 Aug 2023 14:26:12 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 2e134a16b4b32ce9; Fri, 4 Aug 2023 23:26:10 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id F29F1661680; Fri, 4 Aug 2023 23:26:09 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 02/10] thermal: core: Introduce thermal_zone_device_adjust() Date: Fri, 04 Aug 2023 23:03:23 +0200 Message-ID: <3272532.aeNJFYEL58@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Introduce a new thermal zone device operation called .update() for modifying thermal zone components such as trip point and a new helper function, thermal_zone_device_adjust(), that can be used by drivers providing the new thermal zone device operation to invoke it under the zone lock. Signed-off-by: Rafael J. Wysocki --- New patch in v4. --- drivers/thermal/thermal_core.c | 20 ++++++++++++++++++++ include/linux/thermal.h | 2 ++ 2 files changed, 22 insertions(+) Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -74,6 +74,7 @@ struct thermal_zone_device_ops { enum thermal_trend *); void (*hot)(struct thermal_zone_device *); void (*critical)(struct thermal_zone_device *); + void (*update)(struct thermal_zone_device *, unsigned long); }; /** @@ -323,6 +324,7 @@ int thermal_zone_unbind_cooling_device(s struct thermal_cooling_device *); void thermal_zone_device_update(struct thermal_zone_device *, enum thermal_notify_event); +void thermal_zone_device_adjust(struct thermal_zone_device *tz, unsigned long data); struct thermal_cooling_device *thermal_cooling_device_register(const char *, void *, const struct thermal_cooling_device_ops *); Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -497,6 +497,26 @@ void thermal_zone_device_update(struct t } EXPORT_SYMBOL_GPL(thermal_zone_device_update); +/** + * thermal_zone_device_adjust - Adjust a thermal zone. + * @tz: Thermal zone. + * @data: Data to pass to the zone's .update() callback. + * + * Modify components of a thermal zone (for example, trip points) via + * its .update() callback (for example, after a platform configuration + * change). + */ +void thermal_zone_device_adjust(struct thermal_zone_device *tz, unsigned long data) +{ + mutex_lock(&tz->lock); + + if (device_is_registered(&tz->device) && tz->ops->update) + tz->ops->update(tz, data); + + mutex_unlock(&tz->lock); +} +EXPORT_SYMBOL_GPL(thermal_zone_device_adjust); + static void thermal_zone_device_check(struct work_struct *work) { struct thermal_zone_device *tz = container_of(work, struct From patchwork Fri Aug 4 21:04:53 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710777 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 1817CC001DB for ; Fri, 4 Aug 2023 21:26:19 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S229831AbjHDV0R (ORCPT ); Fri, 4 Aug 2023 17:26:17 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44086 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230054AbjHDV0N (ORCPT ); Fri, 4 Aug 2023 17:26:13 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 6704C2D7E; Fri, 4 Aug 2023 14:26:11 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id dec5b0a88e15fbd9; Fri, 4 Aug 2023 23:26:09 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 38F00661680; Fri, 4 Aug 2023 23:26:09 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 03/10] thermal: core: Add priv pointer to struct thermal_trip Date: Fri, 04 Aug 2023 23:04:53 +0200 Message-ID: <10344810.nUPlyArG6x@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Add a new field called priv to struct thermal_trip to allow thermal drivers to store pointers to their local data associated with trip points. Signed-off-by: Rafael J. Wysocki Acked-by: Daniel Lezcano --- New patch in v4. --- include/linux/thermal.h | 2 ++ 1 file changed, 2 insertions(+) Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -82,11 +82,13 @@ struct thermal_zone_device_ops { * @temperature: temperature value in miliCelsius * @hysteresis: relative hysteresis in miliCelsius * @type: trip point type + * @priv: pointer to driver data associated with this trip */ struct thermal_trip { int temperature; int hysteresis; enum thermal_trip_type type; + void *priv; }; struct thermal_cooling_device_ops { From patchwork Fri Aug 4 21:05:40 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710545 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 2EC3FC04FDF for ; Fri, 4 Aug 2023 21:26:18 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231193AbjHDV0Q (ORCPT ); Fri, 4 Aug 2023 17:26:16 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44072 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231140AbjHDV0M (ORCPT ); Fri, 4 Aug 2023 17:26:12 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id AED66E46; Fri, 4 Aug 2023 14:26:10 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id cae361074099a2a1; Fri, 4 Aug 2023 23:26:09 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 7A7AB661680; Fri, 4 Aug 2023 23:26:08 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 04/10] thermal: core: Add thermal_zone_update_trip_temp() helper routine Date: Fri, 04 Aug 2023 23:05:40 +0200 Message-ID: <1967710.PYKUYFuaPT@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Introduce a helper routine called thermal_zone_update_trip_temp() that can be used to update a trip point's temperature with the help of a pointer to local data associated with that trip point provided by the thermal driver that created it. Signed-off-by: Rafael J. Wysocki --- New patch in v4. --- drivers/thermal/thermal_trip.c | 37 +++++++++++++++++++++++++++++++++++++ include/linux/thermal.h | 4 ++++ 2 files changed, 41 insertions(+) Index: linux-pm/drivers/thermal/thermal_trip.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_trip.c +++ linux-pm/drivers/thermal/thermal_trip.c @@ -180,3 +180,40 @@ int thermal_zone_set_trip(struct thermal return 0; } + +/** + * thermal_zone_update_trip_temp - Update the trip point temperature. + * @tz: Thermal zone. + * @trip_priv: Trip tag. + * @temp: New trip temperature. + * + * This only works for thermal zones using trip tables and its caller must + * ensure that the zone lock is held before using it. + * + * @trip_priv is expected to be the value that has been stored by the driver + * in the struct thermal_trip representing the trip point in question, so it + * can be matched against the value of the priv field in that structure. + * + * If @trip_priv does not match any trip point in the trip table of @tz, + * nothing happens. + */ +void thermal_zone_update_trip_temp(struct thermal_zone_device *tz, + void *trip_priv, int temperature) +{ + int i; + + lockdep_assert_held(&tz->lock); + + if (!tz->trips || !trip_priv) + return; + + for (i = 0; i < tz->num_trips; i++) { + struct thermal_trip *trip = &tz->trips[i]; + + if (trip->priv == trip_priv) { + trip->temperature = temperature; + return; + } + } +} +EXPORT_SYMBOL_GPL(thermal_zone_update_trip_temp); Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -286,9 +286,13 @@ int __thermal_zone_get_trip(struct therm struct thermal_trip *trip); int thermal_zone_get_trip(struct thermal_zone_device *tz, int trip_id, struct thermal_trip *trip); +void thermal_zone_update_trip_temp(struct thermal_zone_device *tz, + void *trip_priv, int temperature); int thermal_zone_set_trip(struct thermal_zone_device *tz, int trip_id, const struct thermal_trip *trip); +void thermal_zone_update_trip_temp(struct thermal_zone_device *tz, + void *trip_priv, int temperature); int thermal_zone_get_num_trips(struct thermal_zone_device *tz); From patchwork Fri Aug 4 21:07:18 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710778 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id BB29FC001DB for ; Fri, 4 Aug 2023 21:26:15 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231154AbjHDV0N (ORCPT ); Fri, 4 Aug 2023 17:26:13 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44050 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230498AbjHDV0L (ORCPT ); Fri, 4 Aug 2023 17:26:11 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DADA8E43; Fri, 4 Aug 2023 14:26:09 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 22f7f0f302ddf991; Fri, 4 Aug 2023 23:26:08 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B344C661680; Fri, 4 Aug 2023 23:26:07 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 05/10] ACPI: thermal: Clean up acpi_thermal_register_thermal_zone() Date: Fri, 04 Aug 2023 23:07:18 +0200 Message-ID: <7582643.EvYhyI6sBW@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Rename the trips variable in acpi_thermal_register_thermal_zone() to trip_count so its name better reflects the purpose, rearrange white space in the loop over active trips for clarity and reduce code duplication related to calling thermal_zone_device_register() by using an extra local variable to store the passive delay value. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: No changes. v2 -> v3: No changes. v1 -> v2: No changes. --- drivers/acpi/thermal.c | 36 ++++++++++++++++-------------------- 1 file changed, 16 insertions(+), 20 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -745,34 +745,30 @@ static void acpi_thermal_zone_sysfs_remo static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { - int trips = 0; + int passive_delay = 0; + int trip_count = 0; int result; acpi_status status; int i; if (tz->trips.critical.valid) - trips++; + trip_count++; if (tz->trips.hot.valid) - trips++; - - if (tz->trips.passive.valid) - trips++; - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; - i++, trips++); - - if (tz->trips.passive.valid) - tz->thermal_zone = thermal_zone_device_register("acpitz", trips, 0, tz, - &acpi_thermal_zone_ops, NULL, - tz->trips.passive.tsp * 100, - tz->polling_frequency * 100); - else - tz->thermal_zone = - thermal_zone_device_register("acpitz", trips, 0, tz, - &acpi_thermal_zone_ops, NULL, - 0, tz->polling_frequency * 100); + trip_count++; + if (tz->trips.passive.valid) { + trip_count++; + passive_delay = tz->trips.passive.tsp * 100; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) + trip_count++; + + tz->thermal_zone = thermal_zone_device_register("acpitz", trip_count, 0, + tz, &acpi_thermal_zone_ops, + NULL, passive_delay, + tz->polling_frequency * 100); if (IS_ERR(tz->thermal_zone)) return -ENODEV; From patchwork Fri Aug 4 21:13:08 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710546 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 13A54C04FE2 for ; Fri, 4 Aug 2023 21:26:14 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231147AbjHDV0M (ORCPT ); Fri, 4 Aug 2023 17:26:12 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44046 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230488AbjHDV0K (ORCPT ); Fri, 4 Aug 2023 17:26:10 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 23EC8B1; Fri, 4 Aug 2023 14:26:08 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 6d6d931799418004; Fri, 4 Aug 2023 23:26:07 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id F0C4C661680; Fri, 4 Aug 2023 23:26:06 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 06/10] ACPI: thermal: Carry out trip point updates under zone lock Date: Fri, 04 Aug 2023 23:13:08 +0200 Message-ID: <3205670.5fSG56mABF@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki There is a race condition between acpi_thermal_trips_update() and acpi_thermal_check_fn(), because the trip points may get updated while the latter is running which in theory may lead to inconsistent results. For example, if two trips are updated together, using the temperature value of one of them from before the update and the temperature value of the other one from after the update may not lead to the expected outcome. Moreover, if thermal_get_trend() runs when a trip points update is in progress, it may end up using stale trip point temperatures. To address this, make acpi_thermal_trips_update() call thermal_zone_device_adjust() to carry out the trip points update and provide a new acpi_thermal_adjust_thermal_zone() wrapper around __acpi_thermal_trips_update() as the callback function for the latter. While at it, change the acpi_thermal_trips_update() return data type to void as that function always returns 0 anyway. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: * Rework to use thermal_zone_device_adjust() and the .update() callback instead of using the (exported) zone lock directly. * Call acpi_queue_thermal_check() from acpi_thermal_trips_update() which allows code duplication in acpi_thermal_notify() to be reduced. v2 -> v3: No changes. v1 -> v2: * Hold the thermal zone lock instead of thermal_check_lock around trip point updates (this also helps to protect thermal_get_trend() from using stale trip temperatures). * Add a comment documenting the purpose of the locking. * Make acpi_thermal_trips_update() void. --- drivers/acpi/thermal.c | 41 ++++++++++++++++++++++++++++------------- 1 file changed, 28 insertions(+), 13 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -190,7 +190,7 @@ static int acpi_thermal_get_polling_freq return 0; } -static int acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; unsigned long long tmp; @@ -398,17 +398,39 @@ static int acpi_thermal_trips_update(str ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "device"); } } +} - return 0; +static void acpi_thermal_adjust_thermal_zone(struct thermal_zone_device *thermal, + unsigned long data) +{ + __acpi_thermal_trips_update(thermal_zone_device_priv(thermal), data); +} + +static void acpi_queue_thermal_check(struct acpi_thermal *tz) +{ + if (!work_pending(&tz->thermal_check_work)) + queue_work(acpi_thermal_pm_queue, &tz->thermal_check_work); +} + +static void acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +{ + /* + * Use thermal_zone_device_adjust() to carry out the trip points + * update, so as to protect thermal_get_trend() from getting stale + * trip point temperatures and to prevent thermal_zone_device_update() + * invoked from acpi_thermal_check_fn() from producing inconsistent + * results. + */ + thermal_zone_device_adjust(tz->thermal_zone, flag); + acpi_queue_thermal_check(tz); } static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { - int i, ret = acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); bool valid; + int i; - if (ret) - return ret; + __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); valid = tz->trips.critical.valid | tz->trips.hot.valid | @@ -715,6 +737,7 @@ static struct thermal_zone_device_ops ac .get_trend = thermal_get_trend, .hot = acpi_thermal_zone_device_hot, .critical = acpi_thermal_zone_device_critical, + .update = acpi_thermal_adjust_thermal_zone, }; static int acpi_thermal_zone_sysfs_add(struct acpi_thermal *tz) @@ -815,12 +838,6 @@ static void acpi_thermal_unregister_ther Driver Interface -------------------------------------------------------------------------- */ -static void acpi_queue_thermal_check(struct acpi_thermal *tz) -{ - if (!work_pending(&tz->thermal_check_work)) - queue_work(acpi_thermal_pm_queue, &tz->thermal_check_work); -} - static void acpi_thermal_notify(acpi_handle handle, u32 event, void *data) { struct acpi_device *device = data; @@ -835,13 +852,11 @@ static void acpi_thermal_notify(acpi_han break; case ACPI_THERMAL_NOTIFY_THRESHOLDS: acpi_thermal_trips_update(tz, ACPI_TRIPS_THRESHOLDS); - acpi_queue_thermal_check(tz); acpi_bus_generate_netlink_event(device->pnp.device_class, dev_name(&device->dev), event, 0); break; case ACPI_THERMAL_NOTIFY_DEVICES: acpi_thermal_trips_update(tz, ACPI_TRIPS_DEVICES); - acpi_queue_thermal_check(tz); acpi_bus_generate_netlink_event(device->pnp.device_class, dev_name(&device->dev), event, 0); break; From patchwork Fri Aug 4 21:18:10 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710779 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id B5725C001DE for ; Fri, 4 Aug 2023 21:26:13 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231130AbjHDV0M (ORCPT ); Fri, 4 Aug 2023 17:26:12 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44040 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230422AbjHDV0K (ORCPT ); Fri, 4 Aug 2023 17:26:10 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 751A2E60; Fri, 4 Aug 2023 14:26:08 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 3627b7821fbcc242; Fri, 4 Aug 2023 23:26:06 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 4E705661680; Fri, 4 Aug 2023 23:26:06 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 07/10] ACPI: thermal: Use trip point table to register thermal zones Date: Fri, 04 Aug 2023 23:18:10 +0200 Message-ID: <1987843.usQuhbGJ8B@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Make the ACPI thermal driver use thermal_zone_device_register_with_trips() to register its thermal zones. For this purpose, make it create a trip point table that will be passed to thermal_zone_device_register_with_trips() as an argument. Also use the thermal_zone_update_trip_temp() helper introduced previously to update temperatures of the passive and active trip points after a trip points change notification from the platform firmware. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: * Rework to use thermal_zone_update_trip_temp() for updating trip point temperatures. * Rebase on top of the new version of the previous patch. v2 -> v3: * Fix error code path memory leak in acpi_thermal_register_thermal_zone(). * Notice that the critical and hot trips never change after initialization, so don't add struct thermal_trip_ref to any of them. v1 -> v2: * Use thermal_zone_device_lock()/thermal_zone_device_unlock() in acpi_thermal_check_fn() explicitly and call __thermal_zone_device_update() from there without unlocking the thermal zone. * Export __thermal_zone_device_update() to modules (so it can be called by the ACPI thermal code). --- drivers/acpi/thermal.c | 95 ++++++++++++++++++++++++++++++++++++++++++++----- 1 file changed, 87 insertions(+), 8 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -137,6 +137,7 @@ struct acpi_thermal { unsigned long polling_frequency; volatile u8 zombie; struct acpi_thermal_trips trips; + struct thermal_trip *trip_table; struct acpi_handle_list devices; struct thermal_zone_device *thermal_zone; int kelvin_offset; /* in millidegrees */ @@ -190,6 +191,22 @@ static int acpi_thermal_get_polling_freq return 0; } +static int acpi_thermal_temp(struct acpi_thermal *tz, int temp_deci_k) +{ + if (temp_deci_k == THERMAL_TEMP_INVALID) + return THERMAL_TEMP_INVALID; + + return deci_kelvin_to_millicelsius_with_offset(temp_deci_k, + tz->kelvin_offset); +} + +static void acpi_thermal_update_trip_temp(struct acpi_thermal *tz, + void *trip_priv, int temp_deci_k) +{ + thermal_zone_update_trip_temp(tz->thermal_zone, trip_priv, + acpi_thermal_temp(tz, temp_deci_k)); +} + static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; @@ -403,7 +420,28 @@ static void __acpi_thermal_trips_update( static void acpi_thermal_adjust_thermal_zone(struct thermal_zone_device *thermal, unsigned long data) { - __acpi_thermal_trips_update(thermal_zone_device_priv(thermal), data); + struct acpi_thermal *tz = thermal_zone_device_priv(thermal); + int i; + + __acpi_thermal_trips_update(tz, data); + + if (tz->trips.passive.valid) + acpi_thermal_update_trip_temp(tz, &tz->trips.passive, + tz->trips.passive.temperature); + else + thermal_zone_update_trip_temp(tz->thermal_zone, + &tz->trips.passive, + THERMAL_TEMP_INVALID); + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + if (tz->trips.active[i].valid) + acpi_thermal_update_trip_temp(tz, &tz->trips.active[i], + tz->trips.active[i].temperature); + else + thermal_zone_update_trip_temp(tz->thermal_zone, + &tz->trips.active[i], + THERMAL_TEMP_INVALID); + } } static void acpi_queue_thermal_check(struct acpi_thermal *tz) @@ -768,6 +806,7 @@ static void acpi_thermal_zone_sysfs_remo static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { + struct thermal_trip *trip; int passive_delay = 0; int trip_count = 0; int result; @@ -788,12 +827,50 @@ static int acpi_thermal_register_thermal for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) trip_count++; - tz->thermal_zone = thermal_zone_device_register("acpitz", trip_count, 0, - tz, &acpi_thermal_zone_ops, - NULL, passive_delay, - tz->polling_frequency * 100); - if (IS_ERR(tz->thermal_zone)) - return -ENODEV; + trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); + if (!trip) + return -ENOMEM; + + tz->trip_table = trip; + + if (tz->trips.critical.valid) { + trip->type = THERMAL_TRIP_CRITICAL; + trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); + trip++; + } + + if (tz->trips.hot.valid) { + trip->type = THERMAL_TRIP_HOT; + trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip++; + } + + if (tz->trips.passive.valid) { + trip->type = THERMAL_TRIP_PASSIVE; + trip->temperature = acpi_thermal_temp(tz, tz->trips.passive.temperature); + trip->priv = &tz->trips.passive; + trip++; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) { + trip->type = THERMAL_TRIP_ACTIVE; + trip->temperature = acpi_thermal_temp(tz, tz->trips.active[i].temperature); + trip->priv = &tz->trips.active[i]; + trip++; + } + + tz->thermal_zone = thermal_zone_device_register_with_trips("acpitz", + tz->trip_table, + trip_count, + 0, tz, + &acpi_thermal_zone_ops, + NULL, + passive_delay, + tz->polling_frequency * 100); + if (IS_ERR(tz->thermal_zone)) { + result = PTR_ERR(tz->thermal_zone); + goto free_trip_table; + } result = acpi_thermal_zone_sysfs_add(tz); if (result) @@ -821,6 +898,8 @@ remove_links: acpi_thermal_zone_sysfs_remove(tz); unregister_tzd: thermal_zone_device_unregister(tz->thermal_zone); +free_trip_table: + kfree(tz->trip_table); return result; } @@ -829,6 +908,7 @@ static void acpi_thermal_unregister_ther { acpi_thermal_zone_sysfs_remove(tz); thermal_zone_device_unregister(tz->thermal_zone); + kfree(tz->trip_table); tz->thermal_zone = NULL; acpi_bus_detach_private_data(tz->device->handle); } From patchwork Fri Aug 4 21:22:57 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710547 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 34BF4C04FE0 for ; Fri, 4 Aug 2023 21:26:12 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230483AbjHDV0K (ORCPT ); Fri, 4 Aug 2023 17:26:10 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44034 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230208AbjHDV0J (ORCPT ); Fri, 4 Aug 2023 17:26:09 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id B1052E46; Fri, 4 Aug 2023 14:26:07 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 82f67363ccf29e27; Fri, 4 Aug 2023 23:26:06 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 8B747661680; Fri, 4 Aug 2023 23:26:05 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 08/10] ACPI: thermal: Rework thermal_get_trend() Date: Fri, 04 Aug 2023 23:22:57 +0200 Message-ID: <23199624.6Emhk5qWAg@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Rework the ACPI thermal driver's .get_trend() callback function, thermal_get_trend(), so that it does not call thermal_get_trip_type() and thermal_get_trip_temp() which are going to be dropped. This reduces the overhead of the function too, because it will always carry out a trip point lookup once after the change. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: * Adjust for the lack of a direct way to get from the local trip point representations to trips[i]. v2 -> v3: Rebase on top of the v2 of the previous patch. v1 -> v2: * Do not acquire thermal_check_lock in thermal_get_trend() (lockdep would complain about this, because it is hold around thermal zone locking and .get_trend() runs under the thermal zone lock). The thermal zone locking added in the previous patches is sufficient to protect this code. * Check trips against invalid temperature values. * Return an error for trips other than passive and active. --- drivers/acpi/thermal.c | 68 +++++++++++++++++++++++++++---------------------- 1 file changed, 38 insertions(+), 30 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -616,46 +616,54 @@ static int thermal_get_crit_temp(struct } static int thermal_get_trend(struct thermal_zone_device *thermal, - int trip, enum thermal_trend *trend) + int trip_index, enum thermal_trend *trend) { struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - enum thermal_trip_type type; - int i; + int t, i; - if (thermal_get_trip_type(thermal, trip, &type)) + if (!tz || trip_index < 0) return -EINVAL; - if (type == THERMAL_TRIP_ACTIVE) { - int trip_temp; - int temp = deci_kelvin_to_millicelsius_with_offset( - tz->temperature, tz->kelvin_offset); - if (thermal_get_trip_temp(thermal, trip, &trip_temp)) - return -EINVAL; + if (tz->trips.critical.valid) + trip_index--; - if (temp > trip_temp) { + if (tz->trips.hot.valid) + trip_index--; + + if (trip_index < 0) + return -EINVAL; + + if (tz->trips.passive.valid && !trip_index--) { + t = tz->trips.passive.tc1 * (tz->temperature - + tz->last_temperature) + + tz->trips.passive.tc2 * (tz->temperature - + tz->trips.passive.temperature); + if (t > 0) *trend = THERMAL_TREND_RAISING; - return 0; - } else { - /* Fall back on default trend */ - return -EINVAL; - } + else if (t < 0) + *trend = THERMAL_TREND_DROPPING; + else + *trend = THERMAL_TREND_STABLE; + + return 0; } - /* - * tz->temperature has already been updated by generic thermal layer, - * before this callback being invoked - */ - i = tz->trips.passive.tc1 * (tz->temperature - tz->last_temperature) + - tz->trips.passive.tc2 * (tz->temperature - tz->trips.passive.temperature); - - if (i > 0) - *trend = THERMAL_TREND_RAISING; - else if (i < 0) - *trend = THERMAL_TREND_DROPPING; - else - *trend = THERMAL_TREND_STABLE; + t = acpi_thermal_temp(tz, tz->temperature); + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + if (tz->trips.active[i].valid && !trip_index--) { + int trip_temp; + + trip_temp = acpi_thermal_temp(tz, tz->trips.active[i].temperature); + if (t > trip_temp) { + *trend = THERMAL_TREND_RAISING; + return 0; + } + break; + } + } - return 0; + return -EINVAL; } static void acpi_thermal_zone_device_hot(struct thermal_zone_device *thermal) From patchwork Fri Aug 4 21:24:49 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710780 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 5C898C04FDF for ; Fri, 4 Aug 2023 21:26:11 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230386AbjHDV0J (ORCPT ); Fri, 4 Aug 2023 17:26:09 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44028 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229831AbjHDV0I (ORCPT ); Fri, 4 Aug 2023 17:26:08 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 07769E43; Fri, 4 Aug 2023 14:26:06 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 1a94c3a7d9aba577; Fri, 4 Aug 2023 23:26:05 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id CC1F1661680; Fri, 4 Aug 2023 23:26:04 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 09/10] ACPI: thermal: Drop unnecessary thermal zone callbacks Date: Fri, 04 Aug 2023 23:24:49 +0200 Message-ID: <4314197.ejJDZkT8p0@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Drop the .get_trip_type(), .get_trip_temp() and .get_crit_temp() thermal zone callbacks that are not necessary any more from the ACPI thermal driver along with the corresponding callback functions. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: No changes. v2 -> v3: Rebase on top of the v2 of the previous patch. v1 -> v2: No changes. --- drivers/acpi/thermal.c | 115 ------------------------------------------------- 1 file changed, 115 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -503,118 +503,6 @@ static int thermal_get_temp(struct therm return 0; } -static int thermal_get_trip_type(struct thermal_zone_device *thermal, - int trip, enum thermal_trip_type *type) -{ - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - int i; - - if (!tz || trip < 0) - return -EINVAL; - - if (tz->trips.critical.valid) { - if (!trip) { - *type = THERMAL_TRIP_CRITICAL; - return 0; - } - trip--; - } - - if (tz->trips.hot.valid) { - if (!trip) { - *type = THERMAL_TRIP_HOT; - return 0; - } - trip--; - } - - if (tz->trips.passive.valid) { - if (!trip) { - *type = THERMAL_TRIP_PASSIVE; - return 0; - } - trip--; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) { - if (!trip) { - *type = THERMAL_TRIP_ACTIVE; - return 0; - } - trip--; - } - - return -EINVAL; -} - -static int thermal_get_trip_temp(struct thermal_zone_device *thermal, - int trip, int *temp) -{ - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - int i; - - if (!tz || trip < 0) - return -EINVAL; - - if (tz->trips.critical.valid) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.critical.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - if (tz->trips.hot.valid) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.hot.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - if (tz->trips.passive.valid) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.passive.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && - tz->trips.active[i].valid; i++) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.active[i].temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - return -EINVAL; -} - -static int thermal_get_crit_temp(struct thermal_zone_device *thermal, - int *temperature) -{ - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - - if (tz->trips.critical.valid) { - *temperature = deci_kelvin_to_millicelsius_with_offset( - tz->trips.critical.temperature, - tz->kelvin_offset); - return 0; - } - - return -EINVAL; -} - static int thermal_get_trend(struct thermal_zone_device *thermal, int trip_index, enum thermal_trend *trend) { @@ -777,9 +665,6 @@ static struct thermal_zone_device_ops ac .bind = acpi_thermal_bind_cooling_device, .unbind = acpi_thermal_unbind_cooling_device, .get_temp = thermal_get_temp, - .get_trip_type = thermal_get_trip_type, - .get_trip_temp = thermal_get_trip_temp, - .get_crit_temp = thermal_get_crit_temp, .get_trend = thermal_get_trend, .hot = acpi_thermal_zone_device_hot, .critical = acpi_thermal_zone_device_critical, From patchwork Fri Aug 4 21:25:56 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710548 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 1630BC04A6A for ; Fri, 4 Aug 2023 21:26:10 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230111AbjHDV0J (ORCPT ); Fri, 4 Aug 2023 17:26:09 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44022 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229471AbjHDV0I (ORCPT ); Fri, 4 Aug 2023 17:26:08 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id B63A7B1; Fri, 4 Aug 2023 14:26:06 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 89dbf995bddbbc18; Fri, 4 Aug 2023 23:26:04 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 1C7DB661680; Fri, 4 Aug 2023 23:26:04 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 10/10] thermal: core: Eliminate code duplication from acpi_thermal_notify() Date: Fri, 04 Aug 2023 23:25:56 +0200 Message-ID: <3600617.R56niFO833@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Move the acpi_bus_generate_netlink_event() invocation into acpi_thermal_trips_update() which allows the code duplication in acpi_thermal_notify() to be cleaned up, but for this purpose the event value needs to be passed to acpi_thermal_trips_update() and from there to acpi_thermal_adjust_thermal_zone() which has to determine the flag value for __acpi_thermal_trips_update() by itself. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 20 ++++++++++---------- 1 file changed, 10 insertions(+), 10 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -421,9 +421,11 @@ static void acpi_thermal_adjust_thermal_ unsigned long data) { struct acpi_thermal *tz = thermal_zone_device_priv(thermal); + int flag = data == ACPI_THERMAL_NOTIFY_THRESHOLDS ? + ACPI_TRIPS_THRESHOLDS : ACPI_TRIPS_DEVICES; int i; - __acpi_thermal_trips_update(tz, data); + __acpi_thermal_trips_update(tz, flag); if (tz->trips.passive.valid) acpi_thermal_update_trip_temp(tz, &tz->trips.passive, @@ -450,8 +452,10 @@ static void acpi_queue_thermal_check(str queue_work(acpi_thermal_pm_queue, &tz->thermal_check_work); } -static void acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +static void acpi_thermal_trips_update(struct acpi_thermal *tz, u32 event) { + struct acpi_device *adev = tz->device; + /* * Use thermal_zone_device_adjust() to carry out the trip points * update, so as to protect thermal_get_trend() from getting stale @@ -459,8 +463,10 @@ static void acpi_thermal_trips_update(st * invoked from acpi_thermal_check_fn() from producing inconsistent * results. */ - thermal_zone_device_adjust(tz->thermal_zone, flag); + thermal_zone_device_adjust(tz->thermal_zone, event); acpi_queue_thermal_check(tz); + acpi_bus_generate_netlink_event(adev->pnp.device_class, + dev_name(&adev->dev), event, 0); } static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) @@ -824,14 +830,8 @@ static void acpi_thermal_notify(acpi_han acpi_queue_thermal_check(tz); break; case ACPI_THERMAL_NOTIFY_THRESHOLDS: - acpi_thermal_trips_update(tz, ACPI_TRIPS_THRESHOLDS); - acpi_bus_generate_netlink_event(device->pnp.device_class, - dev_name(&device->dev), event, 0); - break; case ACPI_THERMAL_NOTIFY_DEVICES: - acpi_thermal_trips_update(tz, ACPI_TRIPS_DEVICES); - acpi_bus_generate_netlink_event(device->pnp.device_class, - dev_name(&device->dev), event, 0); + acpi_thermal_trips_update(tz, event); break; default: acpi_handle_debug(device->handle, "Unsupported event [0x%x]\n",