From patchwork Fri Aug 4 21:07:18 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 710314 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id F1DF3C00528 for ; Fri, 4 Aug 2023 21:26:15 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231166AbjHDV0O (ORCPT ); Fri, 4 Aug 2023 17:26:14 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44050 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230498AbjHDV0L (ORCPT ); Fri, 4 Aug 2023 17:26:11 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DADA8E43; Fri, 4 Aug 2023 14:26:09 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 22f7f0f302ddf991; Fri, 4 Aug 2023 23:26:08 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B344C661680; Fri, 4 Aug 2023 23:26:07 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 05/10] ACPI: thermal: Clean up acpi_thermal_register_thermal_zone() Date: Fri, 04 Aug 2023 23:07:18 +0200 Message-ID: <7582643.EvYhyI6sBW@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Rename the trips variable in acpi_thermal_register_thermal_zone() to trip_count so its name better reflects the purpose, rearrange white space in the loop over active trips for clarity and reduce code duplication related to calling thermal_zone_device_register() by using an extra local variable to store the passive delay value. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: No changes. v2 -> v3: No changes. v1 -> v2: No changes. --- drivers/acpi/thermal.c | 36 ++++++++++++++++-------------------- 1 file changed, 16 insertions(+), 20 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -745,34 +745,30 @@ static void acpi_thermal_zone_sysfs_remo static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { - int trips = 0; + int passive_delay = 0; + int trip_count = 0; int result; acpi_status status; int i; if (tz->trips.critical.valid) - trips++; + trip_count++; if (tz->trips.hot.valid) - trips++; - - if (tz->trips.passive.valid) - trips++; - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; - i++, trips++); - - if (tz->trips.passive.valid) - tz->thermal_zone = thermal_zone_device_register("acpitz", trips, 0, tz, - &acpi_thermal_zone_ops, NULL, - tz->trips.passive.tsp * 100, - tz->polling_frequency * 100); - else - tz->thermal_zone = - thermal_zone_device_register("acpitz", trips, 0, tz, - &acpi_thermal_zone_ops, NULL, - 0, tz->polling_frequency * 100); + trip_count++; + if (tz->trips.passive.valid) { + trip_count++; + passive_delay = tz->trips.passive.tsp * 100; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) + trip_count++; + + tz->thermal_zone = thermal_zone_device_register("acpitz", trip_count, 0, + tz, &acpi_thermal_zone_ops, + NULL, passive_delay, + tz->polling_frequency * 100); if (IS_ERR(tz->thermal_zone)) return -ENODEV;